PTM Viewer PTM Viewer

AT5G06210.1

Arabidopsis thaliana [ath]

RNA binding (RRM/RBD/RNP motifs) family protein

No PTMs currently found

PLAZA: AT5G06210
Gene Family: HOM05D000142
Other Names: S-RBP11,small RNA-binding protein 11

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 146

MAALARIGGRHLKSVCLINSSASCFFTQRRGVASKLFIGGLSFCTTEQGLSEAFSKCGQVVEAQIVMDRVSDRSKGFGFVTFASADEAQKALMEFNGQQLNGRTIFVDYAKAKQSLGGGGGYPIARGPPDPAVIAATRTTETSKSD

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR000504 34 112
Molecule Processing
Show Type From To
Transit Peptide 1 31

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here